- Recombinant Human Testis-specific XK-related protein, Y-linked 2 (XKRY2)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1254973
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 12,988 Da
- E Coli or Yeast
- 1-117
- XK, Kell blood group complex subunit-related, Y-linked 2
- XKRYP7
- Testis-specific XK-related protein, Y-linked 2 (XKRY2)
Sequence
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVVTLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS